peptide yy human

Name: peptide yy human
Brand: Jinan Shenghe Chemical Co., Ltd.
SKU: 27309

CAS 118997-30-1C194H295N55O57MW 4310

peptide yy human (CAS 118997-30-1) — formula C194H295N55O57, molecular weight 4310.

Product Description

peptide yy human (CAS 118997-30-1) is classified under Food Additives, with molecular formula C194H295N55O57 and molecular weight 4310, and serves as a key raw material in the food and beverage industry — commonly applied as a food additive, nutritional supplement, or processing aid where regulatory-grade purity is required. Jinan Shenghe Chemical Co., Ltd. supplies peptide yy human at commercial scale with stable lot-to-lot quality, accompanied by COA and full specification documentation. Typical categorization: Food Additives.

Product Overview

CAS Number	118997-30-1
Molecular Formula	C194H295N55O57
Molecular Weight	4310
LogP	-13.8

Technical Profile

What this product is

peptide yy human is a chemical compound with CAS registry number 118997-30-1 and molecular formula C194H295N55O57 (molecular weight 4310).

Identification

CAS number: 118997-30-1

Its molecular formula C194H295N55O57 comprises 194 C, 295 H, 55 N, 57 O atoms.

Also known as: peptide yy human · 肽 yy 人类

Frequently Asked Questions

What is the CAS number of peptide yy human?

The CAS registry number of peptide yy human is 118997-30-1.

What is the molecular formula and molecular weight of peptide yy human?

Molecular formula C194H295N55O57, molecular weight 4310.

What other names is peptide yy human known by?

It is also registered under: peptide yy human, 肽 yy 人类.

PubChem Public Data

Independent reference data for peptide yy human (CAS 118997-30-1), compiled from public chemistry databases.

Registry identifiers across databases

CAS Registry Number	118997-30-1
PubChem CID	126455957
Molecular formula	C194H295N55O57
UNII (FDA)	T2670C12I5

Computed descriptors

Molecular Weight	4310
XLogP3	-13.8
Hydrogen Bond Donor Count	63
Hydrogen Bond Acceptor Count	64
Rotatable Bond Count	138
Exact Mass	4309.1942976
Monoisotopic Mass	4307.1875879
Topological Polar Surface Area	1830
Heavy Atom Count	306

Synonyms and trade names

Peptide yy human; 118997-30-1; Peptide YY, human; Peptide YY [MI]; Peptide yy (1-36); PYY (1-36) peptide; Peptide YY (human) trifluoroacetate salt; UNII-T2670C12I5; PYY(1-36); T2670C12I5; SCHEMBL29496288; DA-56694; FP110394; G12304; H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

What the public record says

peptide yy human · CAS 118997-30-1 · C194H295N55O57. UNII T2670C12I5.

Source: PubChem / Wikidata; the batch COA governs where values differ.